PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_005718-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 422aa    MW: 47309.8 Da    PI: 7.5647
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_005718-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++q+G g+W+++++  g+ R++k+c++rw +yl
  AHYPO_005718-RA 14 KGLWSPEEDEKLLRHITQYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.67.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  AHYPO_005718-RA  67 RGAFSQEEENLIIELHAVLGNK-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.469961IPR017930Myb domain
SuperFamilySSF466892.43E-2912108IPR009057Homeodomain-like
SMARTSM007173.8E-131363IPR001005SANT/Myb domain
PfamPF002494.5E-151461IPR001005SANT/Myb domain
CDDcd001671.73E-111761No hitNo description
PROSITE profilePS5129426.04762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665117IPR009057Homeodomain-like
SMARTSM007176.4E-1366114IPR001005SANT/Myb domain
PfamPF002499.0E-1467111IPR001005SANT/Myb domain
CDDcd001675.10E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT QYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEENLIIE LHAVLGNKWS QIAAQLPGRT DNEIKNLWNS CLKKKLKQRG  120
IDPNTHKPLS EIEIQEEKAK SNTNTNANHI NCSKTNTNTN TNTRNTDKFS VSTIIQNDNF  180
NTNTNTNTNT ITTTPNKTTP MVYQQSLSTH EFFPDSLYGS FGFQCFGSTH QAHSSNIIPS  240
MIPFMDIMGQ PTDTAGYNGF HNMDIPTATT TTATTTSTSH EDSTNTNNNN NNNNAGSFFD  300
NYSWVSSSKN TNNNNNNNNN NNNNNNNNNN NGLEGTNTNP DEIKWSEYLQ TPLLLAPLNQ  360
TNNGGVNNNY GEIKTELNYI TSSSPWQQNQ QSSSSIIPAF HGSDLYNKDL QRLAEAFGQI  420
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674459.11e-151PREDICTED: transcription factor MYB86
TrEMBLA0A0J8CQ171e-151A0A0J8CQ17_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.19e-90myb domain protein 61